Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families) |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein automated matches [190184] (2 species) not a true protein |
Species Streptomyces lividans [TaxId:1916] [186922] (9 PDB entries) |
Domain d2jk5c_: 2jk5 C: [205074] Other proteins in same PDB: d2jk5a1, d2jk5a2, d2jk5b1, d2jk5b2 automated match to d1s5hc_ complexed with co, f09, hp6, k, l2c, tba |
PDB Entry: 2jk5 (more details), 2.4 Å
SCOPe Domain Sequences for d2jk5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jk5c_ f.14.1.1 (C:) automated matches {Streptomyces lividans [TaxId: 1916]} salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh
Timeline for d2jk5c_:
View in 3D Domains from other chains: (mouse over for more information) d2jk5a1, d2jk5a2, d2jk5b1, d2jk5b2 |