Lineage for d2jk5c_ (2jk5 C:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577060Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2577061Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
    Pfam PF00520
  5. 2577062Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2577167Protein automated matches [190184] (3 species)
    not a true protein
  7. 2577176Species Streptomyces lividans [TaxId:1916] [186922] (11 PDB entries)
  8. 2577185Domain d2jk5c_: 2jk5 C: [205074]
    Other proteins in same PDB: d2jk5a1, d2jk5a2, d2jk5a3, d2jk5b1, d2jk5b2
    automated match to d1s5hc_
    complexed with co, f09, hp6, k, l2c, tba

Details for d2jk5c_

PDB Entry: 2jk5 (more details), 2.4 Å

PDB Description: Potassium Channel KcsA in complex with Tetrabutylammonium in high K
PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2jk5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jk5c_ f.14.1.1 (C:) automated matches {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOPe Domain Coordinates for d2jk5c_:

Click to download the PDB-style file with coordinates for d2jk5c_.
(The format of our PDB-style files is described here.)

Timeline for d2jk5c_: