SCOP 1.73: Domain d1bzqk_: 1bzq K:

Lineage for d1bzqk_ (1bzq K:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Camelid IG heavy chain variable domain, VHh [88563] (2 species)

7. Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (13 PDB entries)

8. Domain d1bzqk_: 1bzq K: [20507]
   Other proteins in same PDB: d1bzqa_, d1bzqb_, d1bzqc_, d1bzqd_

Details for d1bzqk_

PDB Entry: 1bzq, 2.8 Å

PDB Description: complex of a dromedary single-domain vhh antibody fragment with rnase a

PDB Compounds: (K:) protein (antibody cab-rn05)

SCOP Domain Sequences for d1bzqk_:

Sequence; same for both SEQRES and ATOM records:

>d1bzqk_ b.1.1.1 (K:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggtly
adsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvtvs
srgr

Timeline for d1bzqk_:

• d1bzqk_ first appeared (with stable ids) in SCOP 1.55
  
• d1bzqk_ appears in SCOP 1.71
  
• d1bzqk_ appears in SCOP 1.75
  
• d1bzqk_ appears in the current release, SCOPe 2.08