Lineage for d2jjva_ (2jjv A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (919 PDB entries)
  8. 2026834Domain d2jjva_: 2jjv A: [205068]
    automated match to d2i26o_
    complexed with cl, so4

Details for d2jjva_

PDB Entry: 2jjv (more details), 1.8 Å

PDB Description: structure of human signal regulatory protein (sirp) beta(2)
PDB Compounds: (A:) signal-regulatory protein beta 1.

SCOPe Domain Sequences for d2jjva_:

Sequence, based on SEQRES records: (download)

>d2jjva_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elqviqpdksisvaagesatlhctvtslipvgpiqwfrgagpgreliynqkeghfprvtt
vsdltkrnnmdfsirisnitpadagtyycvkfrkgspdhvefksgagtelsvr

Sequence, based on observed residues (ATOM records): (download)

>d2jjva_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elqviqpdksisvaagesatlhctvtslipvgpiqwfrgagpgreliynqhfprvttvsd
ltkrnnmdfsirisnitpadagtyycvkfrkgspdhvefksgagtelsvr

SCOPe Domain Coordinates for d2jjva_:

Click to download the PDB-style file with coordinates for d2jjva_.
(The format of our PDB-style files is described here.)

Timeline for d2jjva_: