SCOPe 2.05: Domain d2jjub_: 2jju B:

Lineage for d2jjub_ (2jju B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d2jjub_: 2jju B: [205067]
   automated match to d2jjwa_
   complexed with cl, so4

Details for d2jjub_

PDB Entry: 2jju, 1.19 Å

PDB Description: structure of human signal regulatory protein (sirp) beta

PDB Compounds: (B:) signal regulatory protein beta-1

SCOPe Domain Sequences for d2jjub_:

Sequence, based on SEQRES records:

>d2jjub_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elqviqpeksvsvaagesatlrcamtslipvgpimwfrgagagreliynqkeghfprvtt
vseltkrnnldfsisisnitpadagtyycvkfrkgspddvefksgagtelsvra

Sequence, based on observed residues (ATOM records):

>d2jjub_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elqviqpeksvsvaagesatlrcamtslipvgpimwfrgagagreliynqkeghfprvtt
vseltkrnnldfsisisnitpadagtyycvkfrkgddvefksgagtelsvra

Timeline for d2jjub_:

• d2jjub_ first appeared in SCOPe 2.03
  
• d2jjub_ appears in SCOPe 2.04
  
• d2jjub_ appears in SCOPe 2.06
  
• d2jjub_ appears in the current release, SCOPe 2.08