Lineage for d2jjta_ (2jjt A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295971Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)
  8. 1296291Domain d2jjta_: 2jjt A: [205064]
    automated match to d2i26o_
    complexed with nag

Details for d2jjta_

PDB Entry: 2jjt (more details), 2.3 Å

PDB Description: structure of human cd47 in complex with human signal regulatory protein (sirp) alpha
PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type substrate 1

SCOPe Domain Sequences for d2jjta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jjta_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elqviqpdksvsvaagesailhctvtslipvgpiqwfrgagpareliynqkeghfprvtt
vsestkrenmdfsisisnitpadagtyycvkfrkgspdtefksgagtelsvra

SCOPe Domain Coordinates for d2jjta_:

Click to download the PDB-style file with coordinates for d2jjta_.
(The format of our PDB-style files is described here.)

Timeline for d2jjta_: