Lineage for d2jjsb1 (2jjs B:1-118)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (996 PDB entries)
  8. 2355454Domain d2jjsb1: 2jjs B:1-118 [205063]
    Other proteins in same PDB: d2jjsb2
    automated match to d2i26o_
    complexed with iod, nag

Details for d2jjsb1

PDB Entry: 2jjs (more details), 1.85 Å

PDB Description: structure of human cd47 in complex with human signal regulatory protein (sirp) alpha
PDB Compounds: (B:) tyrosine-protein phosphatase non-receptor type substrate 1

SCOPe Domain Sequences for d2jjsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jjsb1 b.1.1.0 (B:1-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eeelqviqpdksvsvaagesailhctvtslipvgpiqwfrgagpareliynqkeghfprv
ttvsestkrenmdfsisisnitpadagtyycvkfrkgspdtefksgagtelsvrakps

SCOPe Domain Coordinates for d2jjsb1:

Click to download the PDB-style file with coordinates for d2jjsb1.
(The format of our PDB-style files is described here.)

Timeline for d2jjsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jjsb2
View in 3D
Domains from other chains:
(mouse over for more information)
d2jjsa_