Class a: All alpha proteins [46456] (285 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (40 species) not a true protein |
Species Saccharopolyspora erythraea [TaxId:1836] [225746] (5 PDB entries) |
Domain d2jjpa_: 2jjp A: [205061] automated match to d1z8oa_ complexed with hem, kln, so4 |
PDB Entry: 2jjp (more details), 2.1 Å
SCOPe Domain Sequences for d2jjpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jjpa_ a.104.1.0 (A:) automated matches {Saccharopolyspora erythraea [TaxId: 1836]} lttidevpgmadetalldwlgtmrekqpvwqdrygvwhvfrhadvqtvlrdtatfssdpt rviegasptpgmiheidppehralrkvvssaftprtisdleprirdvtrslladagesfd lvdvlafplpvtivaellglppmdheqfgdwsgalvdiqmddptdpalaeriadvlnplt aylkarcaerradpgddlisrlvlaevdgralddeeaanfstalllaghitttvllgniv rtldehpahwdaaaedpgripaiveevlryrppfpqmqrtttkatevagvpipadvmvnt wvlsanrdsdahddpdrfdpsrksggaaqlsfghgvhfclgaplarlenrvaleeiiarf grltvdrdderlrhfeqivlgtrhlpvlagssprqsa
Timeline for d2jjpa_: