SCOP 1.63: Domain d1melb_: 1mel B:

Lineage for d1melb_ (1mel B:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Camel (Camelus dromedarius), anti-lysozyme antibody [48914] (4 PDB entries)
   single-domain VH fragment

8. Domain d1melb_: 1mel B: [20506]
   Other proteins in same PDB: d1mell_, d1melm_

Details for d1melb_

PDB Entry: 1mel, 2.5 Å

PDB Description: crystal structure of a camel single-domain vh antibody fragment in complex with lysozyme

SCOP Domain Sequences for d1melb_:

Sequence; same for both SEQRES and ATOM records:

>d1melb_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Camel (Camelus dromedarius), anti-lysozyme antibody}
vqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainmgggityya
dsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygyd
swgqgtqvtvss

Timeline for d1melb_:

• d1melb_ first appeared (with stable ids) in SCOP 1.55
  
• d1melb_ appears in SCOP 1.61
  
• d1melb_ appears in SCOP 1.65
  
• d1melb_ appears in the current release, SCOPe 2.08