Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Camel (Camelus dromedarius), anti-lysozyme antibody [48914] (4 PDB entries) single-domain VH fragment |
Domain d1melb_: 1mel B: [20506] Other proteins in same PDB: d1mell_, d1melm_ |
PDB Entry: 1mel (more details), 2.5 Å
SCOP Domain Sequences for d1melb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1melb_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Camel (Camelus dromedarius), anti-lysozyme antibody} vqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainmgggityya dsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygyd swgqgtqvtvss
Timeline for d1melb_: