![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Saccharopolyspora erythraea [TaxId:1836] [225746] (6 PDB entries) |
![]() | Domain d2jjna_: 2jjn A: [205059] automated match to d1z8oa_ complexed with hem, so4 |
PDB Entry: 2jjn (more details), 1.59 Å
SCOPe Domain Sequences for d2jjna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jjna_ a.104.1.0 (A:) automated matches {Saccharopolyspora erythraea [TaxId: 1836]} tidevpgmadetalldwlgtmrekqpvwqdrygvwhvfrhadvqtvlrdtatfssdptrv iegasptpgmiheidppehralrkvvssaftprtisdleprirdvtrslladagesfdlv dvlafplpvtivaellglppmdheqfgdwsgalvdiqmddptdpalaeriadvlnpltay lkarcaerradpgddlisrlvlaevdgralddeeaanfstalllaghitttvllgnivrt ldehpahwdaaaedpgripaiveevlryrppfpqmqrtttkatevagvpipadvmvntwv lsanrdsdahddpdrfdpsrksggaaqlsfghgvhfclgaplarlenrvaleeiiarfgr ltvdrdderlrhfeqivlgtrhlpvlagssprqsa
Timeline for d2jjna_: