Lineage for d2jila_ (2jil A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2786490Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2786491Protein automated matches [190436] (9 species)
    not a true protein
  7. 2786505Species Human (Homo sapiens) [TaxId:9606] [187333] (104 PDB entries)
  8. 2786571Domain d2jila_: 2jil A: [205057]
    automated match to d2ozfa_
    complexed with edo, scn

Details for d2jila_

PDB Entry: 2jil (more details), 1.5 Å

PDB Description: crystal structure of 2nd pdz domain of glutamate receptor interacting protein-1 (grip1)
PDB Compounds: (A:) glutamate receptor interacting protein-1

SCOPe Domain Sequences for d2jila_:

Sequence, based on SEQRES records: (download)

>d2jila_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smrtvevtlhkegntfgfvirggahddrnksrpvvitsvrpggpadregtikpgdrllsv
dgirllgtthaeamsilkqcgqeaallieydvsetav

Sequence, based on observed residues (ATOM records): (download)

>d2jila_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smrtvevtlhkegntfgfvirggahddrsrpvvitsvrpggpadregtikpgdrllsvdg
irllgtthaeamsilkqcgqeaallieydvsetav

SCOPe Domain Coordinates for d2jila_:

Click to download the PDB-style file with coordinates for d2jila_.
(The format of our PDB-style files is described here.)

Timeline for d2jila_: