SCOPe 2.03: Domain d2jifd2: 2jif D:280-432

Lineage for d2jifd2 (2jif D:280-432)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225243] (3 PDB entries)

8. Domain d2jifd2: 2jif D:280-432 [205056]
   Other proteins in same PDB: d2jifa1, d2jifb1, d2jifc1, d2jifd1
   automated match to d1rx0a1
   complexed with cl, cos, edo, fad

Details for d2jifd2

PDB Entry: 2jif, 2 Å

PDB Description: structure of human short-branched chain acyl-coa dehydrogenase (acadsb)

PDB Compounds: (D:) short/branched chain specific acyl-coa dehydrogenase

SCOPe Domain Sequences for d2jifd2:

Sequence; same for both SEQRES and ATOM records:

>d2jifd2 a.29.3.0 (D:280-432) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ghgykyaigslnegrigiaaqmlglaqgcfdytipyikeriqfgkrlfdfqglqhqvahv
atqleaarlltynaarlleagkpfikeasmakyyaseiagqttskciewmggvgytkdyp
vekyfrdakigtiyegasniqlntiakhidaey

Timeline for d2jifd2:

• d2jifd2 is new in SCOPe 2.03-stable
  
• d2jifd2 appears in SCOPe 2.04
  
• d2jifd2 appears in the current release, SCOPe 2.08