| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
| Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
| Protein automated matches [226935] (30 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225243] (4 PDB entries) |
| Domain d2jifd2: 2jif D:280-432 [205056] Other proteins in same PDB: d2jifa1, d2jifb1, d2jifc1, d2jifd1 automated match to d1rx0a1 complexed with cl, cos, edo, fad |
PDB Entry: 2jif (more details), 2 Å
SCOPe Domain Sequences for d2jifd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jifd2 a.29.3.0 (D:280-432) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ghgykyaigslnegrigiaaqmlglaqgcfdytipyikeriqfgkrlfdfqglqhqvahv
atqleaarlltynaarlleagkpfikeasmakyyaseiagqttskciewmggvgytkdyp
vekyfrdakigtiyegasniqlntiakhidaey
Timeline for d2jifd2: