Lineage for d2jifb1 (2jif B:56-279)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246106Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2246107Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2246252Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 2246253Protein automated matches [226934] (25 species)
    not a true protein
  7. 2246358Species Human (Homo sapiens) [TaxId:9606] [225242] (2 PDB entries)
  8. 2246360Domain d2jifb1: 2jif B:56-279 [205051]
    Other proteins in same PDB: d2jifa2, d2jifb2, d2jifc2, d2jifd2
    automated match to d1rx0a2
    complexed with cl, cos, edo, fad

Details for d2jifb1

PDB Entry: 2jif (more details), 2 Å

PDB Description: structure of human short-branched chain acyl-coa dehydrogenase (acadsb)
PDB Compounds: (B:) short/branched chain specific acyl-coa dehydrogenase

SCOPe Domain Sequences for d2jifb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jifb1 e.6.1.0 (B:56-279) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tftdeemmikssvkkfaqeqiaplvstmdenskmeksviqglfqqglmgievdpeyggtg
asflstvlvieelakvdasvavfceiqntlintlirkhgteeqkatylpqlttekvgsfc
lseagagsdsfalktradkegdyyvlngskmwissaehaglflvmanvdptigykgitsf
lvdrdtpglhigkpenklglrasstcpltfenvkvpeanilgqi

SCOPe Domain Coordinates for d2jifb1:

Click to download the PDB-style file with coordinates for d2jifb1.
(The format of our PDB-style files is described here.)

Timeline for d2jifb1: