Lineage for d2jifa2 (2jif A:280-432)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708478Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2708479Protein automated matches [226935] (30 species)
    not a true protein
  7. 2708584Species Human (Homo sapiens) [TaxId:9606] [225243] (4 PDB entries)
  8. 2708593Domain d2jifa2: 2jif A:280-432 [205050]
    Other proteins in same PDB: d2jifa1, d2jifb1, d2jifc1, d2jifd1
    automated match to d1rx0a1
    complexed with cl, cos, edo, fad

Details for d2jifa2

PDB Entry: 2jif (more details), 2 Å

PDB Description: structure of human short-branched chain acyl-coa dehydrogenase (acadsb)
PDB Compounds: (A:) short/branched chain specific acyl-coa dehydrogenase

SCOPe Domain Sequences for d2jifa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jifa2 a.29.3.0 (A:280-432) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ghgykyaigslnegrigiaaqmlglaqgcfdytipyikeriqfgkrlfdfqglqhqvahv
atqleaarlltynaarlleagkpfikeasmakyyaseiagqttskciewmggvgytkdyp
vekyfrdakigtiyegasniqlntiakhidaey

SCOPe Domain Coordinates for d2jifa2:

Click to download the PDB-style file with coordinates for d2jifa2.
(The format of our PDB-style files is described here.)

Timeline for d2jifa2: