Lineage for d1mela_ (1mel A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287101Protein Camelid IG heavy chain variable domain, VHh [88563] (2 species)
  7. 287102Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (11 PDB entries)
  8. 287121Domain d1mela_: 1mel A: [20505]
    Other proteins in same PDB: d1mell_, d1melm_

Details for d1mela_

PDB Entry: 1mel (more details), 2.5 Å

PDB Description: crystal structure of a camel single-domain vh antibody fragment in complex with lysozyme
PDB Compounds: (A:)

SCOP Domain Sequences for d1mela_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mela_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius)}
vqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainmgggityya
dsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygyd
swgqgtqvtvss

SCOP Domain Coordinates for d1mela_:

Click to download the PDB-style file with coordinates for d1mela_.
(The format of our PDB-style files is described here.)

Timeline for d1mela_: