| Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
| Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) ![]() flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
| Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
| Protein automated matches [226934] (14 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225242] (2 PDB entries) |
| Domain d2jifa1: 2jif A:52-279 [205049] Other proteins in same PDB: d2jifa2, d2jifb2, d2jifc2, d2jifd2 automated match to d1rx0a2 complexed with cl, cos, edo, fad |
PDB Entry: 2jif (more details), 2 Å
SCOPe Domain Sequences for d2jifa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jifa1 e.6.1.0 (A:52-279) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aplqtftdeemmikssvkkfaqeqiaplvstmdenskmeksviqglfqqglmgievdpey
ggtgasflstvlvieelakvdasvavfceiqntlintlirkhgteeqkatylpqlttekv
gsfclseagagsdsfalktradkegdyyvlngskmwissaehaglflvmanvdptigykg
itsflvdrdtpglhigkpenklglrasstcpltfenvkvpeanilgqi
Timeline for d2jifa1: