Lineage for d2ji4a1 (2ji4 A:19-178)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2891980Species Human (Homo sapiens) [TaxId:9606] [225156] (13 PDB entries)
  8. 2892007Domain d2ji4a1: 2ji4 A:19-178 [205047]
    automated match to d2c4ka1
    complexed with cl

Details for d2ji4a1

PDB Entry: 2ji4 (more details), 2.55 Å

PDB Description: human phosphoribosylpyrophosphate synthetase - associated protein 41 (pap41)
PDB Compounds: (A:) phosphoribosyl pyrophosphate synthetase-associated protein 2

SCOPe Domain Sequences for d2ji4a1:

Sequence, based on SEQRES records: (download)

>d2ji4a1 c.61.1.0 (A:19-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glvlfsansnsscmelskkiaerlgvemgkvqvyqepnretrvqiqesvrgkdvfiiqtv
skdvnttimellimvyacktscaksiigvipyfpyskqckmrkrgsivskllasmmckag
lthlitmdlhqkeiqgffnipvdnlraspfllqyiqeeip

Sequence, based on observed residues (ATOM records): (download)

>d2ji4a1 c.61.1.0 (A:19-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glvlfsansnsscmelskkiaerlgvemgkvqvyqepnretrvqiqesvrgkdvfiiqtv
skdvnttimellimvyacktscaksiigvipyfpyskqsivskllasmmckaglthlitm
dlhqkeiqgffnipvdnlraspfllqyiqeeip

SCOPe Domain Coordinates for d2ji4a1:

Click to download the PDB-style file with coordinates for d2ji4a1.
(The format of our PDB-style files is described here.)

Timeline for d2ji4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ji4a2