Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.8: RhoGDI-like [81288] (3 proteins) |
Protein automated matches [190534] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187499] (8 PDB entries) |
Domain d2jhxa_: 2jhx A: [205045] automated match to d2jhya_ mutant |
PDB Entry: 2jhx (more details), 1.6 Å
SCOPe Domain Sequences for d2jhxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jhxa_ b.1.18.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs gmkyiqhtyrkgvkidktdymvgsygpraehyhfltpveeapkgmlargsysiksrftdd dktdhlswewnltikkdw
Timeline for d2jhxa_: