Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
Protein automated matches [190117] (40 species) not a true protein |
Species Staphylococcus aureus [TaxId:93061] [225257] (2 PDB entries) |
Domain d2jgvd1: 2jgv D:1-310 [205044] Other proteins in same PDB: d2jgva2, d2jgvb2, d2jgvc2, d2jgvd2 automated match to d2awdb_ complexed with adp |
PDB Entry: 2jgv (more details), 2 Å
SCOPe Domain Sequences for d2jgvd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jgvd1 c.72.1.0 (D:1-310) automated matches {Staphylococcus aureus [TaxId: 93061]} miltltlnpsvdisypltalklddvnrvqevsktaggkglnvtrvlaqvgepvlasgfig gelgqfiakkldhadikhafynikgetrnciailhegqqteileqgpeidnqeaagfikh feqllekveavaisgslpkglnqdyyaqiiercqnkgvpvildcsgatlqtvlenpykpt vikpniselyqllnqpldesleslkqavsqplfegiewiivslgaqgafakhnhtfyrvn iptisvlnpvgsgdstvagitsailnhendhdllkkantlgmlnaqeaqtgyvnlnnydd lfnqievlev
Timeline for d2jgvd1: