SCOPe 2.03: Domain d1vhpa_: 1vhp A:

Lineage for d1vhpa_ (1vhp A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (68 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody

8. Domain d1vhpa_: 1vhp A: [20504]
   camelized monomeric VH

Details for d1vhpa_

PDB Entry: 1vhp

PDB Description: vh-p8, nmr

PDB Compounds: (A:) vh-p8

SCOPe Domain Sequences for d1vhpa_:

Sequence; same for both SEQRES and ATOM records:

>d1vhpa_ b.1.1.1 (A:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvesggglvqpggslrlscaasgftfssyamswvrqapgkereivsavsgsggstyy
adsvkgrftisrdnskntlylqmnslraedtavyycarlkkyafdywgqgtlvtvss

Timeline for d1vhpa_:

• d1vhpa_ first appeared (with stable ids) in SCOP 1.55, called d1vhp__
  
• d1vhpa_ appears in SCOPe 2.02
  
• d1vhpa_ appears in SCOPe 2.04
  
• d1vhpa_ appears in the current release, SCOPe 2.08