Lineage for d1vhpa_ (1vhp A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781740Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 781741Species Engineered (including hybrid species) [88562] (67 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831
    SQ NA # humanized antibody
    SQ NA # Humanized antibody
    SQ NA # engineered antibody
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody
  8. 781838Domain d1vhpa_: 1vhp A: [20504]
    camelized monomeric VH

Details for d1vhpa_

PDB Entry: 1vhp (more details)

PDB Description: vh-p8, nmr
PDB Compounds: (A:) vh-p8

SCOP Domain Sequences for d1vhpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhpa_ b.1.1.1 (A:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvesggglvqpggslrlscaasgftfssyamswvrqapgkereivsavsgsggstyy
adsvkgrftisrdnskntlylqmnslraedtavyycarlkkyafdywgqgtlvtvss

SCOP Domain Coordinates for d1vhpa_:

Click to download the PDB-style file with coordinates for d1vhpa_.
(The format of our PDB-style files is described here.)

Timeline for d1vhpa_: