Lineage for d1vhp__ (1vhp -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 8085Species VH-P8 domain (human), camelized monomer [48913] (1 PDB entry)
  8. 8086Domain d1vhp__: 1vhp - [20504]

Details for d1vhp__

PDB Entry: 1vhp (more details)

PDB Description: vh-p8, nmr

SCOP Domain Sequences for d1vhp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhp__ b.1.1.1 (-) Immunoglobulin (variable domains of L and H chains) {VH-P8 domain (human), camelized monomer}
evqlvesggglvqpggslrlscaasgftfssyamswvrqapgkereivsavsgsggstyy
adsvkgrftisrdnskntlylqmnslraedtavyycarlkkyafdywgqgtlvtvss

SCOP Domain Coordinates for d1vhp__:

Click to download the PDB-style file with coordinates for d1vhp__.
(The format of our PDB-style files is described here.)

Timeline for d1vhp__: