![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
![]() | Species VH-P8 domain (human), camelized monomer [48913] (1 PDB entry) |
![]() | Domain d1vhp__: 1vhp - [20504] |
PDB Entry: 1vhp (more details)
SCOP Domain Sequences for d1vhp__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vhp__ b.1.1.1 (-) Immunoglobulin (variable domains of L and H chains) {VH-P8 domain (human), camelized monomer} evqlvesggglvqpggslrlscaasgftfssyamswvrqapgkereivsavsgsggstyy adsvkgrftisrdnskntlylqmnslraedtavyycarlkkyafdywgqgtlvtvss
Timeline for d1vhp__: