Lineage for d2jgua1 (2jgu A:1-347)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2495032Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2495033Protein automated matches [190396] (40 species)
    not a true protein
  7. 2495312Species Pyrococcus furiosus [TaxId:2261] [224898] (3 PDB entries)
  8. 2495316Domain d2jgua1: 2jgu A:1-347 [205039]
    Other proteins in same PDB: d2jgua2
    automated match to d2vwja1
    complexed with mn

Details for d2jgua1

PDB Entry: 2jgu (more details), 2.6 Å

PDB Description: crystal structure of dna-directed dna polymerase
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d2jgua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jgua1 c.55.3.0 (A:1-347) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mildvdyiteegkpvirlfkkengkfkiehdrtfrpyiyallrddskieevkkitgerhg
kivrivdvekvekkflgkpitvwklylehpqdvptlrekvrehpavvdifeydipfakry
lidkglipmegeeelkilafdietlyhegeefgkgpiimisyadenearvitwknidlpy
vesvstekemikrflriirekdpdiivtyngdsfdfpylakraeklgikltigrdgsepk
mqrigdmtavevkgrihfdlyhvirttinlptytleavyeaifgkpkekvyadeiakawe
sgenlervakysmedakatyelgkeflpmeiqlsrlvgqplwdvsrs

SCOPe Domain Coordinates for d2jgua1:

Click to download the PDB-style file with coordinates for d2jgua1.
(The format of our PDB-style files is described here.)

Timeline for d2jgua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jgua2