Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (20 species) not a true protein |
Species Pyrococcus furiosus [TaxId:2261] [224898] (3 PDB entries) |
Domain d2jgua1: 2jgu A:1-347 [205039] Other proteins in same PDB: d2jgua2 automated match to d2vwja1 complexed with mn |
PDB Entry: 2jgu (more details), 2.6 Å
SCOPe Domain Sequences for d2jgua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jgua1 c.55.3.0 (A:1-347) automated matches {Pyrococcus furiosus [TaxId: 2261]} mildvdyiteegkpvirlfkkengkfkiehdrtfrpyiyallrddskieevkkitgerhg kivrivdvekvekkflgkpitvwklylehpqdvptlrekvrehpavvdifeydipfakry lidkglipmegeeelkilafdietlyhegeefgkgpiimisyadenearvitwknidlpy vesvstekemikrflriirekdpdiivtyngdsfdfpylakraeklgikltigrdgsepk mqrigdmtavevkgrihfdlyhvirttinlptytleavyeaifgkpkekvyadeiakawe sgenlervakysmedakatyelgkeflpmeiqlsrlvgqplwdvsrs
Timeline for d2jgua1: