SCOPe 2.03: Domain d2jgqa_: 2jgq A:

Lineage for d2jgqa_ (2jgq A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.0: automated matches [191424] (1 protein)
   not a true family

6. Protein automated matches [190605] (13 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [225412] (1 PDB entry)

8. Domain d2jgqa_: 2jgq A: [205037]
   automated match to d2vxna_
   complexed with po4, qga

Details for d2jgqa_

PDB Entry: 2jgq, 2.3 Å

PDB Description: kinetics and structural properties of triosephosphate isomerase from helicobacter pylori

PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d2jgqa_:

Sequence, based on SEQRES records:

>d2jgqa_ c.1.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
tkiamanfksampifkshaylkelektlkpqhfdrvfvfpdffgllpnsflhftlgvqna
yprdcgaftgeitskhleelkihtllighserrtllkespsflkekfdffksknfkivyc
igeelttrekgfkavkeflseqlenidlnypnlvvayepiwaigtkksaslediylthgf
lkqilnqktpllyggsvntqnakeilgidsvdglligsaswelenfktiisfl

Sequence, based on observed residues (ATOM records):

>d2jgqa_ c.1.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
tkiamanfksampifkshaylkelektlkpqhfdrvfvfpdffgllpnsflhftlgvqna
yprdcgaftgeitskhleelkihtllighserrtllkespsflkekfdffksknfkivyc
igeelttrekgfkavkeflseqlenidlnypnlvvayepiwaigtksaslediylthgfl
kqilnqktpllyggsvntqnakeilgidsvdglligsaswelenfktiisfl

Timeline for d2jgqa_:

• d2jgqa_ is new in SCOPe 2.03-stable
  
• d2jgqa_ appears in SCOPe 2.04
  
• d2jgqa_ appears in the current release, SCOPe 2.08