Lineage for d2jgnc_ (2jgn C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849617Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1849618Protein automated matches [190123] (96 species)
    not a true protein
  7. 1849890Species Human (Homo sapiens) [TaxId:9606] [186862] (102 PDB entries)
  8. 1849923Domain d2jgnc_: 2jgn C: [205036]
    automated match to d1t5ia_

Details for d2jgnc_

PDB Entry: 2jgn (more details), 1.91 Å

PDB Description: DDX3 helicase domain
PDB Compounds: (C:) ATP-dependent RNA helicase DDX3X

SCOPe Domain Sequences for d2jgnc_:

Sequence, based on SEQRES records: (download)

>d2jgnc_ c.37.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
senitqkvvwveesdkrsflldllnatgkdsltlvfvetkkgadsledflyhegyactsi
hgdrsqrdreealhqfrsgkspilvatavaargldisnvkhvinfdlpsdieeyvhrigr
tgrvgnlglatsffnerninitkdlldllveakqevpswlenma

Sequence, based on observed residues (ATOM records): (download)

>d2jgnc_ c.37.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
senitqkvvwveesdkrsflldllntgsltlvfvetkkgadsledflyhegyactsihgd
rsreealhqfrsgkspilvatavaargldisnvkhvinfdlpsdieeyvhrigrtgrvgn
lglatsffnerninitkdlldllveakqevpswlenma

SCOPe Domain Coordinates for d2jgnc_:

Click to download the PDB-style file with coordinates for d2jgnc_.
(The format of our PDB-style files is described here.)

Timeline for d2jgnc_: