Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (49 species) not a true protein |
Species Acanthopagrus schlegeli [TaxId:72011] [225455] (1 PDB entry) |
Domain d2jg7g_: 2jg7 G: [205032] automated match to d1ky8a_ complexed with nad |
PDB Entry: 2jg7 (more details), 2.83 Å
SCOPe Domain Sequences for d2jg7g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jg7g_ c.82.1.0 (G:) automated matches {Acanthopagrus schlegeli [TaxId: 72011]} sgllinqpkyswlkelglsednpgvyngswggsgevitsycpannepiarvtqatlaeye etvqktreawkmwadipapkrgeivrqigdalrkkikvlgslvslemgkiyvegvgevqe yvdvcdyavglsrmiggpvlpserpghalieqwnpvglvgiitafnfpvavygwnnaial tcgnvclwkgapttpltsvavtkivaevleqnnlpgaicsmtcggadigtamakdervdl lsftgsthvgkmvammvqerfgrkllelggnnaiivfedadlnlvvpsavfasvgtagqr ctttrrlmlhesvhdavveriakaykqvrigdpwdpstlygplhtkqavdqylaaieqak qqggtlvcggkvmdrpgnyveptiitglahdapivhtetfvpilyvlkfkteeeafawnn evqqglsssiftkdlgrvfrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresg sdswkqymrrstctinyskdlplaqgikf
Timeline for d2jg7g_: