SCOP 1.55: Domain d1ehlh1: 1ehl H:1-113

Lineage for d1ehlh1 (1ehl H:1-113)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Anti-photoproduct Fab 64M-2, (mouse), kappa L chain [48912] (1 PDB entry)

8. Domain d1ehlh1: 1ehl H:1-113 [20503]
   Other proteins in same PDB: d1ehlh2, d1ehll2

Details for d1ehlh1

PDB Entry: 1ehl, 2.4 Å

PDB Description: 64m-2 antibody fab complexed with d(5ht)(6-4)t

SCOP Domain Sequences for d1ehlh1:

Sequence; same for both SEQRES and ATOM records:

>d1ehlh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-photoproduct Fab 64M-2, (mouse), kappa L chain}
evqlqqsgtvlarpgasvkmsckasgysftsfwmhwvkqrpgqglewigtiypgnsdtsy
nqkfkgkakltavtsastaymevssltnedsavyyctrrsgykyyaldywgqgtsvtvss

Timeline for d1ehlh1:

• d1ehlh1 appears in SCOP 1.57
  
• d1ehlh1 appears in the current release, SCOPe 2.08