Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Anti-photoproduct Fab 64M-2, (mouse), kappa L chain [48912] (1 PDB entry) |
Domain d1ehlh1: 1ehl H:1-113 [20503] Other proteins in same PDB: d1ehlh2, d1ehll2 |
PDB Entry: 1ehl (more details), 2.4 Å
SCOP Domain Sequences for d1ehlh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ehlh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-photoproduct Fab 64M-2, (mouse), kappa L chain} evqlqqsgtvlarpgasvkmsckasgysftsfwmhwvkqrpgqglewigtiypgnsdtsy nqkfkgkakltavtsastaymevssltnedsavyyctrrsgykyyaldywgqgtsvtvss
Timeline for d1ehlh1: