Lineage for d2jg7d_ (2jg7 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141092Species Acanthopagrus schlegeli [TaxId:72011] [225455] (1 PDB entry)
  8. 2141096Domain d2jg7d_: 2jg7 D: [205029]
    automated match to d1ky8a_
    complexed with nad

Details for d2jg7d_

PDB Entry: 2jg7 (more details), 2.83 Å

PDB Description: crystal structure of seabream antiquitin and elucidation of its substrate specificity
PDB Compounds: (D:) antiquitin

SCOPe Domain Sequences for d2jg7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jg7d_ c.82.1.0 (D:) automated matches {Acanthopagrus schlegeli [TaxId: 72011]}
sgllinqpkyswlkelglsednpgvyngswggsgevitsycpannepiarvtqatlaeye
etvqktreawkmwadipapkrgeivrqigdalrkkikvlgslvslemgkiyvegvgevqe
yvdvcdyavglsrmiggpvlpserpghalieqwnpvglvgiitafnfpvavygwnnaial
tcgnvclwkgapttpltsvavtkivaevleqnnlpgaicsmtcggadigtamakdervdl
lsftgsthvgkmvammvqerfgrkllelggnnaiivfedadlnlvvpsavfasvgtagqr
ctttrrlmlhesvhdavveriakaykqvrigdpwdpstlygplhtkqavdqylaaieqak
qqggtlvcggkvmdrpgnyveptiitglahdapivhtetfvpilyvlkfkteeeafawnn
evqqglsssiftkdlgrvfrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresg
sdswkqymrrstctinyskdlplaqgikf

SCOPe Domain Coordinates for d2jg7d_:

Click to download the PDB-style file with coordinates for d2jg7d_.
(The format of our PDB-style files is described here.)

Timeline for d2jg7d_: