SCOPe 2.05: Domain d2jg1c_: 2jg1 C:

Lineage for d2jg1c_ (2jg1 C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.0: automated matches [191321] (1 protein)
   not a true family

6. Protein automated matches [190117] (37 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93061] [225257] (2 PDB entries)

8. Domain d2jg1c_: 2jg1 C: [205024]
   automated match to d2awdb_
   complexed with anp, mg, ta6

Details for d2jg1c_

PDB Entry: 2jg1, 2 Å

PDB Description: structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate

PDB Compounds: (C:) tagatose-6-phosphate kinase

SCOPe Domain Sequences for d2jg1c_:

Sequence; same for both SEQRES and ATOM records:

>d2jg1c_ c.72.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 93061]}
prgshmiltltlnpsvdisypltalklddvnrvqevsktaggkglnvtrvlaqvgepvla
sgfiggelgqfiakkldhadikhafynikgetrnciailhegqqteileqgpeidnqeaa
gfikhfeqmmekveavaisgslpkglnqdyyaqiiercqnkgvpvildcsgatlqtvlen
pykptvikpniselyqllnqpldesleslkqavsqplfegiewiivslgaqgafakhnht
fyrvniptisvlnpvgsgdstvagitsailnhendhdllkkantlgmlnaqeaqtgyvnl
nnyddlfnqievlev

Timeline for d2jg1c_:

• d2jg1c_ first appeared in SCOPe 2.03
  
• d2jg1c_ appears in SCOPe 2.04
  
• d2jg1c_ is called d2jg1c1 in SCOPe 2.06
  
• d2jg1c_ appears in the current release, SCOPe 2.08, called d2jg1c1