Lineage for d2jfab_ (2jfa B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729635Protein automated matches [190059] (14 species)
    not a true protein
  7. 2729657Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries)
  8. 2729881Domain d2jfab_: 2jfa B: [205021]
    automated match to d2pogb_
    protein/DNA complex; complexed with ral, so4

Details for d2jfab_

PDB Entry: 2jfa (more details), 2.55 Å

PDB Description: estrogen receptor alpha lbd in complex with an affinity-selected corepressor peptide
PDB Compounds: (B:) Estrogen receptor

SCOPe Domain Sequences for d2jfab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jfab_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
gfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysm

SCOPe Domain Coordinates for d2jfab_:

Click to download the PDB-style file with coordinates for d2jfab_.
(The format of our PDB-style files is described here.)

Timeline for d2jfab_: