Lineage for d1ehll1 (1ehl L:1-107)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653172Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries)
  8. 653256Domain d1ehll1: 1ehl L:1-107 [20502]
    Other proteins in same PDB: d1ehlh1, d1ehlh2, d1ehll2
    part of anti-photoproduct Fab 64M-2
    complexed with 5ht

Details for d1ehll1

PDB Entry: 1ehl (more details), 2.4 Å

PDB Description: 64m-2 antibody fab complexed with d(5ht)(6-4)t
PDB Compounds: (L:) anti-(6-4) photoproduct antibody 64m-2 fab (light chain)

SCOP Domain Sequences for d1ehll1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehll1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
dvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgslvptfgggtkleik

SCOP Domain Coordinates for d1ehll1:

Click to download the PDB-style file with coordinates for d1ehll1.
(The format of our PDB-style files is described here.)

Timeline for d1ehll1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ehll2