Lineage for d2jc5a_ (2jc5 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988138Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2988139Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2988254Family d.151.1.0: automated matches [191468] (1 protein)
    not a true family
  6. 2988255Protein automated matches [190734] (14 species)
    not a true protein
  7. 2988291Species Neisseria meningitidis [TaxId:487] [187907] (2 PDB entries)
  8. 2988293Domain d2jc5a_: 2jc5 A: [205013]
    automated match to d2v0ra_
    complexed with bcn, dio, gol, mg

Details for d2jc5a_

PDB Entry: 2jc5 (more details), 1.5 Å

PDB Description: apurinic apyrimidinic (ap) endonuclease (nape) from neisseria meningitidis
PDB Compounds: (A:) exodeoxyribonuclease

SCOPe Domain Sequences for d2jc5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jc5a_ d.151.1.0 (A:) automated matches {Neisseria meningitidis [TaxId: 487]}
mlkiisanvngirsaykkgfyeyiaasgadivcvqelkaqeadlsadmknphgmhghwhc
aekrgysgvavyskrkpdnvqigmgieefdregrfvrcdfgrlsvislylpsgssaeerq
qvkyrfldafypmleamknegrdivvcgdwniahqnidlknwkgnqknsgflpeerewig
kvihklgwtdmwrtlypdvpgytwwsnrgqayakdvgwridyqmvtpelaakavsahvyk
dekfsdhaplvveydyaae

SCOPe Domain Coordinates for d2jc5a_:

Click to download the PDB-style file with coordinates for d2jc5a_.
(The format of our PDB-style files is described here.)

Timeline for d2jc5a_: