SCOP 1.71: Domain d1egjh1: 1egj H:1-113

Lineage for d1egjh1 (1egj H:1-113)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)

8. Domain d1egjh1: 1egj H:1-113 [20501]
   Other proteins in same PDB: d1egja_, d1egjh2, d1egjl1, d1egjl2
   part of Fab 13B5 against cytokine receptor common beta chain domain 4
   complexed with nag

Details for d1egjh1

PDB Entry: 1egj, 2.8 Å

PDB Description: domain 4 of the beta common chain in complex with an antibody

SCOP Domain Sequences for d1egjh1:

Sequence; same for both SEQRES and ATOM records:

>d1egjh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
evqlqqsgpelvkpgtsvkmsckasgytftdyymkwvkhshgkslewigdinpsnggtly
nqkfkgkatltvdkssstasmqlsrltsedsavyycsrgdgihggfaywgqgttvtvss

Timeline for d1egjh1:

• d1egjh1 first appeared (with stable ids) in SCOP 1.55
  
• d1egjh1 appears in SCOP 1.69
  
• d1egjh1 appears in SCOP 1.73
  
• d1egjh1 appears in the current release, SCOPe 2.08