SCOP 1.55: Domain d1egjh1: 1egj H:1-113

Lineage for d1egjh1 (1egj H:1-113)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab against cytokyne receptor common beta chain domain 4, (mouse), kappa L chain [48911] (1 PDB entry)

8. Domain d1egjh1: 1egj H:1-113 [20501]
   Other proteins in same PDB: d1egja_, d1egjh2, d1egjl2

Details for d1egjh1

PDB Entry: 1egj, 2.8 Å

PDB Description: domain 4 of the beta common chain in complex with an antibody

SCOP Domain Sequences for d1egjh1:

Sequence; same for both SEQRES and ATOM records:

>d1egjh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab against cytokyne receptor common beta chain domain 4, (mouse), kappa L chain}
evqlqqsgpelvkpgtsvkmsckasgytftdyymkwvkhshgkslewigdinpsnggtly
nqkfkgkatltvdkssstasmqlsrltsedsavyycsrgdgihggfaywgqgttvtvss

Timeline for d1egjh1:

• d1egjh1 appears in SCOP 1.57
  
• d1egjh1 appears in the current release, SCOPe 2.08