Lineage for d2jc2a_ (2jc2 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711466Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)
  6. 2711553Protein automated matches [226948] (1 species)
    not a true protein
  7. 2711554Species Human (Homo sapiens) [TaxId:9606] [225306] (1 PDB entry)
  8. 2711555Domain d2jc2a_: 2jc2 A: [205009]
    automated match to d1juoa_
    complexed with so4; mutant

Details for d2jc2a_

PDB Entry: 2jc2 (more details), 2.5 Å

PDB Description: the crystal structure of the natural f112l human sorcin mutant
PDB Compounds: (A:) sorcin

SCOPe Domain Sequences for d2jc2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jc2a_ a.39.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dplygyfaavagqdgqidadelqrcltqsgiaggykpfnletcrlmvsmldrdmsgtmgf
nefkelwavlngwrqhfisldtdrsgtvdpqelqkalttmgfrlspqavnsiakrystng
kitfddyiaccvklraltdsfrrrdtaqqgvvnfpyddfiqcvmsv

SCOPe Domain Coordinates for d2jc2a_:

Click to download the PDB-style file with coordinates for d2jc2a_.
(The format of our PDB-style files is described here.)

Timeline for d2jc2a_: