![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins) |
![]() | Protein automated matches [226948] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225306] (1 PDB entry) |
![]() | Domain d2jc2a_: 2jc2 A: [205009] automated match to d1juoa_ complexed with so4; mutant |
PDB Entry: 2jc2 (more details), 2.5 Å
SCOPe Domain Sequences for d2jc2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jc2a_ a.39.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dplygyfaavagqdgqidadelqrcltqsgiaggykpfnletcrlmvsmldrdmsgtmgf nefkelwavlngwrqhfisldtdrsgtvdpqelqkalttmgfrlspqavnsiakrystng kitfddyiaccvklraltdsfrrrdtaqqgvvnfpyddfiqcvmsv
Timeline for d2jc2a_: