SCOPe 2.05: Domain d2ja1a2: 2ja1 A:143-191

Lineage for d2ja1a2 (2ja1 A:143-191)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.0: automated matches [191378] (1 protein)
   not a true family

6. Protein automated matches [190463] (6 species)
   not a true protein

7. Species Bacillus cereus [TaxId:1396] [225215] (1 PDB entry)

8. Domain d2ja1a2: 2ja1 A:143-191 [205008]
   Other proteins in same PDB: d2ja1a1
   automated match to d1xx6a2
   complexed with mpd, ttp, zn

Details for d2ja1a2

PDB Entry: 2ja1, 2.8 Å

PDB Description: thymidine kinase from b. cereus with ttp bound as phosphate donor.

PDB Compounds: (A:) Thymidine kinase

SCOPe Domain Sequences for d2ja1a2:

Sequence; same for both SEQRES and ATOM records:

>d2ja1a2 g.39.1.0 (A:143-191) automated matches {Bacillus cereus [TaxId: 1396]}
avcsvcgspasrtqrlidgepaafddpiilvgasesyeprcrhchavpa

Timeline for d2ja1a2:

• d2ja1a2 first appeared in SCOPe 2.03
  
• d2ja1a2 appears in SCOPe 2.04
  
• d2ja1a2 appears in SCOPe 2.06
  
• d2ja1a2 appears in the current release, SCOPe 2.08