Lineage for d2ja1a2 (2ja1 A:143-191)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3036144Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. 3036145Protein automated matches [190463] (9 species)
    not a true protein
  7. 3036148Species Bacillus cereus [TaxId:1396] [225215] (1 PDB entry)
  8. 3036149Domain d2ja1a2: 2ja1 A:143-191 [205008]
    Other proteins in same PDB: d2ja1a1
    automated match to d1xx6a2
    complexed with mpd, ttp, zn

Details for d2ja1a2

PDB Entry: 2ja1 (more details), 2.8 Å

PDB Description: thymidine kinase from b. cereus with ttp bound as phosphate donor.
PDB Compounds: (A:) Thymidine kinase

SCOPe Domain Sequences for d2ja1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja1a2 g.39.1.0 (A:143-191) automated matches {Bacillus cereus [TaxId: 1396]}
avcsvcgspasrtqrlidgepaafddpiilvgasesyeprcrhchavpa

SCOPe Domain Coordinates for d2ja1a2:

Click to download the PDB-style file with coordinates for d2ja1a2.
(The format of our PDB-style files is described here.)

Timeline for d2ja1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ja1a1