Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (156 species) not a true protein |
Species Bacillus cereus [TaxId:1396] [225214] (1 PDB entry) |
Domain d2ja1a1: 2ja1 A:-1-142 [205007] Other proteins in same PDB: d2ja1a2 automated match to d1xx6a1 complexed with mpd, ttp, zn |
PDB Entry: 2ja1 (more details), 2.8 Å
SCOPe Domain Sequences for d2ja1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ja1a1 c.37.1.0 (A:-1-142) automated matches {Bacillus cereus [TaxId: 1396]} gsmylinqngwievicgsmfsgkseelirrvrrtqfakqhaivfkpcidnryseedvvsh nglkvkavpvsaskdifehiteeldviaidevqffdgdivevvqvlanrgyrvivagldq dfrglpfgqvpqlmaiaehvtklq
Timeline for d2ja1a1: