SCOPe 2.05: Domain d2ja1a1: 2ja1 A:-1-142

Lineage for d2ja1a1 (2ja1 A:-1-142)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Bacillus cereus [TaxId:1396] [225214] (1 PDB entry)

8. Domain d2ja1a1: 2ja1 A:-1-142 [205007]
   Other proteins in same PDB: d2ja1a2
   automated match to d1xx6a1
   complexed with mpd, ttp, zn

Details for d2ja1a1

PDB Entry: 2ja1, 2.8 Å

PDB Description: thymidine kinase from b. cereus with ttp bound as phosphate donor.

PDB Compounds: (A:) Thymidine kinase

SCOPe Domain Sequences for d2ja1a1:

Sequence; same for both SEQRES and ATOM records:

>d2ja1a1 c.37.1.0 (A:-1-142) automated matches {Bacillus cereus [TaxId: 1396]}
gsmylinqngwievicgsmfsgkseelirrvrrtqfakqhaivfkpcidnryseedvvsh
nglkvkavpvsaskdifehiteeldviaidevqffdgdivevvqvlanrgyrvivagldq
dfrglpfgqvpqlmaiaehvtklq

Timeline for d2ja1a1:

• d2ja1a1 first appeared in SCOPe 2.03
  
• d2ja1a1 appears in SCOPe 2.04
  
• d2ja1a1 appears in SCOPe 2.06
  
• d2ja1a1 appears in the current release, SCOPe 2.08