Lineage for d2j9ra2 (2j9r A:143-193)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262247Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2262248Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2262786Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. 2262787Protein automated matches [190463] (7 species)
    not a true protein
  7. 2262788Species Bacillus anthracis [TaxId:260799] [225213] (1 PDB entry)
  8. 2262789Domain d2j9ra2: 2j9r A:143-193 [205006]
    Other proteins in same PDB: d2j9ra1, d2j9ra3
    automated match to d1xx6a2
    protein/DNA complex; complexed with po4, thm, zn

Details for d2j9ra2

PDB Entry: 2j9r (more details), 2.7 Å

PDB Description: thymidine kinase from b. anthracis in complex with dt.
PDB Compounds: (A:) Thymidine kinase

SCOPe Domain Sequences for d2j9ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j9ra2 g.39.1.0 (A:143-193) automated matches {Bacillus anthracis [TaxId: 260799]}
avcsacgspasrtqrlidgepaafddpiilvgasesyeprcrhchavptkq

SCOPe Domain Coordinates for d2j9ra2:

Click to download the PDB-style file with coordinates for d2j9ra2.
(The format of our PDB-style files is described here.)

Timeline for d2j9ra2: