![]() | Class g: Small proteins [56992] (94 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
![]() | Family g.39.1.0: automated matches [191378] (1 protein) not a true family |
![]() | Protein automated matches [190463] (7 species) not a true protein |
![]() | Species Bacillus anthracis [TaxId:260799] [225213] (1 PDB entry) |
![]() | Domain d2j9ra2: 2j9r A:143-193 [205006] Other proteins in same PDB: d2j9ra1, d2j9ra3 automated match to d1xx6a2 protein/DNA complex; complexed with po4, thm, zn |
PDB Entry: 2j9r (more details), 2.7 Å
SCOPe Domain Sequences for d2j9ra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j9ra2 g.39.1.0 (A:143-193) automated matches {Bacillus anthracis [TaxId: 260799]} avcsacgspasrtqrlidgepaafddpiilvgasesyeprcrhchavptkq
Timeline for d2j9ra2: