Lineage for d2j9ra2 (2j9r A:143-193)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1965176Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1965177Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1965711Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. 1965712Protein automated matches [190463] (6 species)
    not a true protein
  7. 1965713Species Bacillus anthracis [TaxId:260799] [225213] (1 PDB entry)
  8. 1965714Domain d2j9ra2: 2j9r A:143-193 [205006]
    Other proteins in same PDB: d2j9ra1
    automated match to d1xx6a2
    protein/DNA complex; complexed with po4, thm, zn

Details for d2j9ra2

PDB Entry: 2j9r (more details), 2.7 Å

PDB Description: thymidine kinase from b. anthracis in complex with dt.
PDB Compounds: (A:) Thymidine kinase

SCOPe Domain Sequences for d2j9ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j9ra2 g.39.1.0 (A:143-193) automated matches {Bacillus anthracis [TaxId: 260799]}
avcsacgspasrtqrlidgepaafddpiilvgasesyeprcrhchavptkq

SCOPe Domain Coordinates for d2j9ra2:

Click to download the PDB-style file with coordinates for d2j9ra2.
(The format of our PDB-style files is described here.)

Timeline for d2j9ra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j9ra1