SCOPe 2.05: Domain d2j9ra1: 2j9r A:-1-142

Lineage for d2j9ra1 (2j9r A:-1-142)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:260799] [225212] (1 PDB entry)

8. Domain d2j9ra1: 2j9r A:-1-142 [205005]
   Other proteins in same PDB: d2j9ra2
   automated match to d1xx6a1
   protein/DNA complex; complexed with po4, thm, zn

Details for d2j9ra1

PDB Entry: 2j9r, 2.7 Å

PDB Description: thymidine kinase from b. anthracis in complex with dt.

PDB Compounds: (A:) Thymidine kinase

SCOPe Domain Sequences for d2j9ra1:

Sequence, based on SEQRES records:

>d2j9ra1 c.37.1.0 (A:-1-142) automated matches {Bacillus anthracis [TaxId: 260799]}
shmylinqngwievicgsmfsgkseelirrvrrtqfakqhaivfkpcidnryseedvvsh
nglkvkavpvsaskdifkhiteemdviaidevqffdgdivevvqvlanrgyrvivagldq
dfrglpfgqvpqlmaiaehvtklq

Sequence, based on observed residues (ATOM records):

>d2j9ra1 c.37.1.0 (A:-1-142) automated matches {Bacillus anthracis [TaxId: 260799]}
shmylinqngwievicgsmfsgkseelirrvrrtqfakqhaivfkpcvkavpvsaskdif
khiteemdviaidevqffdgdivevvqvlanrgyrvivagldqdfrglpfgqvpqlmaia
ehvtklq

Timeline for d2j9ra1:

• d2j9ra1 first appeared in SCOPe 2.03
  
• d2j9ra1 appears in SCOPe 2.04
  
• d2j9ra1 appears in SCOPe 2.06
  
• d2j9ra1 appears in the current release, SCOPe 2.08