Lineage for d2j9ra1 (2j9r A:-1-142)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1366119Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1366120Protein automated matches [190123] (58 species)
    not a true protein
  7. 1366135Species Bacillus anthracis [TaxId:260799] [225212] (1 PDB entry)
  8. 1366136Domain d2j9ra1: 2j9r A:-1-142 [205005]
    Other proteins in same PDB: d2j9ra2
    automated match to d1xx6a1
    protein/DNA complex; complexed with po4, thm, zn

Details for d2j9ra1

PDB Entry: 2j9r (more details), 2.7 Å

PDB Description: thymidine kinase from b. anthracis in complex with dt.
PDB Compounds: (A:) Thymidine kinase

SCOPe Domain Sequences for d2j9ra1:

Sequence, based on SEQRES records: (download)

>d2j9ra1 c.37.1.0 (A:-1-142) automated matches {Bacillus anthracis [TaxId: 260799]}
shmylinqngwievicgsmfsgkseelirrvrrtqfakqhaivfkpcidnryseedvvsh
nglkvkavpvsaskdifkhiteemdviaidevqffdgdivevvqvlanrgyrvivagldq
dfrglpfgqvpqlmaiaehvtklq

Sequence, based on observed residues (ATOM records): (download)

>d2j9ra1 c.37.1.0 (A:-1-142) automated matches {Bacillus anthracis [TaxId: 260799]}
shmylinqngwievicgsmfsgkseelirrvrrtqfakqhaivfkpcvkavpvsaskdif
khiteemdviaidevqffdgdivevvqvlanrgyrvivagldqdfrglpfgqvpqlmaia
ehvtklq

SCOPe Domain Coordinates for d2j9ra1:

Click to download the PDB-style file with coordinates for d2j9ra1.
(The format of our PDB-style files is described here.)

Timeline for d2j9ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j9ra2