Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
Protein automated matches [190753] (14 species) not a true protein |
Species Methanococcus jannaschii [TaxId:2190] [225207] (3 PDB entries) |
Domain d2j9ec_: 2j9e C: [205000] automated match to d3ncrc_ complexed with act, akg, atp, cl, mg, na |
PDB Entry: 2j9e (more details), 1.62 Å
SCOPe Domain Sequences for d2j9ec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j9ec_ d.58.5.0 (C:) automated matches {Methanococcus jannaschii [TaxId: 2190]} gsmkkveaiirpekleivkkalsdagyvgmtvsevkgrgvqggiveryrgreyivdlipk vkielvvkeedvdnvidiicenartgnpgdgkifvipvervvrvrtkeegkealle
Timeline for d2j9ec_: