SCOPe 2.03: Domain d1egjl1: 1egj L:1-107

Lineage for d1egjl1 (1egj L:1-107)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (30 PDB entries)

8. Domain d1egjl1: 1egj L:1-107 [20500]
   Other proteins in same PDB: d1egja_, d1egjh1, d1egjh2, d1egjl2
   part of Fab 13B5 against cytokine receptor common beta chain domain 4
   complexed with nag

Details for d1egjl1

PDB Entry: 1egj, 2.8 Å

PDB Description: domain 4 of the beta common chain in complex with an antibody

PDB Compounds: (L:) antibody (light chain)

SCOPe Domain Sequences for d1egjl1:

Sequence; same for both SEQRES and ATOM records:

>d1egjl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
nivltqspaslavslgqratiscranesvysygdsfmhwyqqkpgqppklliylasnlas
gvparfsgsgsrtdftltidpvetddaatyycqqnnedpwtfgggtkleik

Timeline for d1egjl1:

• d1egjl1 first appeared (with stable ids) in SCOP 1.55
  
• d1egjl1 appears in SCOPe 2.02
  
• d1egjl1 appears in SCOPe 2.04
  
• d1egjl1 appears in the current release, SCOPe 2.08