Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Fab against cytokyne receptor common beta chain domain 4, (mouse), kappa L chain [48911] (1 PDB entry) |
Domain d1egjl1: 1egj L:1-107 [20500] Other proteins in same PDB: d1egja_, d1egjh2, d1egjl2 |
PDB Entry: 1egj (more details), 2.8 Å
SCOP Domain Sequences for d1egjl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1egjl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab against cytokyne receptor common beta chain domain 4, (mouse), kappa L chain} nivltqspaslavslgqratiscranesvysygdsfmhwyqqkpgqppklliylasnlas gvparfsgsgsrtdftltidpvetddaatyycqqnnedpwtfgggtkleik
Timeline for d1egjl1: