Lineage for d2j9eb_ (2j9e B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1907450Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 1907708Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 1907709Protein automated matches [190753] (14 species)
    not a true protein
  7. 1907787Species Methanococcus jannaschii [TaxId:2190] [225207] (3 PDB entries)
  8. 1907792Domain d2j9eb_: 2j9e B: [204999]
    automated match to d3ncrc_
    complexed with act, akg, atp, cl, mg, na

Details for d2j9eb_

PDB Entry: 2j9e (more details), 1.62 Å

PDB Description: structure of glnk1 with bound effectors indicates regulatory mechanism for ammonia uptake
PDB Compounds: (B:) hypothetical nitrogen regulatory pii-like protein mj0059

SCOPe Domain Sequences for d2j9eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j9eb_ d.58.5.0 (B:) automated matches {Methanococcus jannaschii [TaxId: 2190]}
gsmkkveaiirpekleivkkalsdagyvgmtvsevkgrgvqggiveryrgreyivdlipk
vkielvvkeedvdnvidiicenartgnpgdgkifvipvervvrvrtkeegkeallehhh

SCOPe Domain Coordinates for d2j9eb_:

Click to download the PDB-style file with coordinates for d2j9eb_.
(The format of our PDB-style files is described here.)

Timeline for d2j9eb_: