SCOPe 2.08: Domain d2j9eb1: 2j9e B:-1-112

Lineage for d2j9eb1 (2j9e B:-1-112)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.0: automated matches [191474] (1 protein)
   not a true family

6. Protein automated matches [190753] (21 species)
   not a true protein

7. Species Methanococcus jannaschii [TaxId:2190] [225207] (3 PDB entries)

8. Domain d2j9eb1: 2j9e B:-1-112 [204999]
   Other proteins in same PDB: d2j9ea2, d2j9eb2, d2j9ec2
   automated match to d3ncrc_
   complexed with act, akg, atp, cl, mg, na

Details for d2j9eb1

PDB Entry: 2j9e, 1.62 Å

PDB Description: structure of glnk1 with bound effectors indicates regulatory mechanism for ammonia uptake

PDB Compounds: (B:) hypothetical nitrogen regulatory pii-like protein mj0059

SCOPe Domain Sequences for d2j9eb1:

Sequence; same for both SEQRES and ATOM records:

>d2j9eb1 d.58.5.0 (B:-1-112) automated matches {Methanococcus jannaschii [TaxId: 2190]}
gsmkkveaiirpekleivkkalsdagyvgmtvsevkgrgvqggiveryrgreyivdlipk
vkielvvkeedvdnvidiicenartgnpgdgkifvipvervvrvrtkeegkeal

Timeline for d2j9eb1:

• d2j9eb1 first appeared in SCOPe 2.03, called d2j9eb_
  
• d2j9eb1 appears in SCOPe 2.07